Lineage for d1zm9e1 (1zm9 E:344-481)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1544039Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 1544040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 1544058Domain d1zm9e1: 1zm9 E:344-481 [125348]
    Other proteins in same PDB: d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9b_, d1zm9c2, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9d_, d1zm9e2, d1zm9e3, d1zm9e4, d1zm9e5, d1zm9f_
    automated match to d1n0vc1
    complexed with p34

Details for d1zm9e1

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm9e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9e1 b.43.3.1 (E:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d1zm9e1:

Click to download the PDB-style file with coordinates for d1zm9e1.
(The format of our PDB-style files is described here.)

Timeline for d1zm9e1: