Lineage for d1zm9a1 (1zm9 A:344-481)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801238Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 801239Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 801246Domain d1zm9a1: 1zm9 A:344-481 [125336]
    Other proteins in same PDB: d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9b1, d1zm9c2, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9d1, d1zm9e2, d1zm9e3, d1zm9e4, d1zm9e5, d1zm9f1
    automatically matched to d1n0ua1
    complexed with dde, p34

Details for d1zm9a1

PDB Entry: 1zm9 (more details), 2.8 Å

PDB Description: Structure of eEF2-ETA in complex with PJ34
PDB Compounds: (A:) Elongation factor 2

SCOP Domain Sequences for d1zm9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm9a1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOP Domain Coordinates for d1zm9a1:

Click to download the PDB-style file with coordinates for d1zm9a1.
(The format of our PDB-style files is described here.)

Timeline for d1zm9a1: