Class b: All beta proteins [48724] (165 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (5 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) |
Domain d1zm9a1: 1zm9 A:344-481 [125336] Other proteins in same PDB: d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5, d1zm9b1, d1zm9c2, d1zm9c3, d1zm9c4, d1zm9c5, d1zm9d1, d1zm9e2, d1zm9e3, d1zm9e4, d1zm9e5, d1zm9f1 automatically matched to d1n0ua1 complexed with dde, p34 |
PDB Entry: 1zm9 (more details), 2.8 Å
SCOP Domain Sequences for d1zm9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm9a1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d1zm9a1:
View in 3D Domains from same chain: (mouse over for more information) d1zm9a2, d1zm9a3, d1zm9a4, d1zm9a5 |