Lineage for d1zm4e1 (1zm4 E:344-481)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402558Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2402559Protein Elongation factor 2 (eEF-2), domain II [82118] (2 species)
  7. 2402560Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 2402579Domain d1zm4e1: 1zm4 E:344-481 [125328]
    Other proteins in same PDB: d1zm4a2, d1zm4a3, d1zm4a4, d1zm4a5, d1zm4b_, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5, d1zm4d_, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4e5, d1zm4f_
    automated match to d1n0vc1
    complexed with tad

Details for d1zm4e1

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm4e1 b.43.3.1 (E:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d1zm4e1:

Click to download the PDB-style file with coordinates for d1zm4e1.
(The format of our PDB-style files is described here.)

Timeline for d1zm4e1: