Lineage for d1zm4b_ (1zm4 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2233862Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2234004Protein automated matches [190133] (5 species)
    not a true protein
  7. 2234068Species Pseudomonas aeruginosa [TaxId:287] [186856] (4 PDB entries)
  8. 2234074Domain d1zm4b_: 1zm4 B: [125321]
    Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a3, d1zm4a4, d1zm4a5, d1zm4c1, d1zm4c2, d1zm4c3, d1zm4c4, d1zm4c5, d1zm4e1, d1zm4e2, d1zm4e3, d1zm4e4, d1zm4e5
    automated match to d1aera_
    complexed with tad

Details for d1zm4b_

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (B:) exotoxin a

SCOPe Domain Sequences for d1zm4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm4b_ d.166.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d1zm4b_:

Click to download the PDB-style file with coordinates for d1zm4b_.
(The format of our PDB-style files is described here.)

Timeline for d1zm4b_: