Lineage for d1zm4a3 (1zm4 A:561-725)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 852987Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 852988Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
    Uniprot P32324
  8. 852998Domain d1zm4a3: 1zm4 A:561-725 [125318]
    Other proteins in same PDB: d1zm4a1, d1zm4a2, d1zm4a4, d1zm4a5, d1zm4b1, d1zm4c1, d1zm4c2, d1zm4c4, d1zm4c5, d1zm4d1, d1zm4e1, d1zm4e2, d1zm4e4, d1zm4e5, d1zm4f1
    automatically matched to d1n0ua3
    complexed with dde, tad

Details for d1zm4a3

PDB Entry: 1zm4 (more details), 2.9 Å

PDB Description: Structure of the eEF2-ETA-bTAD complex
PDB Compounds: (A:) Elongation factor 2

SCOP Domain Sequences for d1zm4a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm4a3 d.14.1.1 (A:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOP Domain Coordinates for d1zm4a3:

Click to download the PDB-style file with coordinates for d1zm4a3.
(The format of our PDB-style files is described here.)

Timeline for d1zm4a3: