Lineage for d1zm3e2 (1zm3 E:2-343)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363094Protein Elongation factor 2 (eEF-2), N-terminal (G) domain [82404] (1 species)
  7. 1363095Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82405] (16 PDB entries)
    Uniprot P32324
  8. 1363123Domain d1zm3e2: 1zm3 E:2-343 [125311]
    Other proteins in same PDB: d1zm3a1, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3b1, d1zm3c1, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3d1, d1zm3e1, d1zm3e3, d1zm3e4, d1zm3e5, d1zm3f1
    automatically matched to d1n0vc2

Details for d1zm3e2

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm3e2:

Sequence, based on SEQRES records: (download)

>d1zm3e2 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtrk
deqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalrv
tdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfart
vesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakmm
drlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvlle
kleivlkgdekdlegkallkvvmrkflpaadallemivlhlp

Sequence, based on observed residues (ATOM records): (download)

>d1zm3e2 c.37.1.8 (E:2-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislys
emsdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqt
etvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgd
vqvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtn
kdtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkal
lkvvmrkflpaadallemivlhlp

SCOPe Domain Coordinates for d1zm3e2:

Click to download the PDB-style file with coordinates for d1zm3e2.
(The format of our PDB-style files is described here.)

Timeline for d1zm3e2: