Lineage for d1zm3d_ (1zm3 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2233862Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2234004Protein automated matches [190133] (5 species)
    not a true protein
  7. 2234068Species Pseudomonas aeruginosa [TaxId:287] [186856] (4 PDB entries)
  8. 2234078Domain d1zm3d_: 1zm3 D: [125309]
    Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3c1, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3e1, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5
    automated match to d1zm9b_

Details for d1zm3d_

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d1zm3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3d_ d.166.1.1 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyasqpg

SCOPe Domain Coordinates for d1zm3d_:

Click to download the PDB-style file with coordinates for d1zm3d_.
(The format of our PDB-style files is described here.)

Timeline for d1zm3d_: