Lineage for d1zm3d1 (1zm3 D:399-602)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737530Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 737531Superfamily d.166.1: ADP-ribosylation [56399] (7 families) (S)
  5. 737532Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 737616Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 737617Species Pseudomonas aeruginosa [TaxId:287] [56407] (9 PDB entries)
  8. 737630Domain d1zm3d1: 1zm3 D:399-602 [125309]
    Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3c1, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3e1, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5
    automatically matched to d1ikpa2
    complexed with dde

Details for d1zm3d1

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (D:) exotoxin a

SCOP Domain Sequences for d1zm3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3d1 d.166.1.1 (D:399-602) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyas

SCOP Domain Coordinates for d1zm3d1:

Click to download the PDB-style file with coordinates for d1zm3d1.
(The format of our PDB-style files is described here.)

Timeline for d1zm3d1: