Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
Protein automated matches [254469] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries) |
Domain d1zm3c4: 1zm3 C:482-560 [125307] Other proteins in same PDB: d1zm3a1, d1zm3a2, d1zm3a3, d1zm3b_, d1zm3c1, d1zm3c2, d1zm3c3, d1zm3d_, d1zm3e1, d1zm3e2, d1zm3e3, d1zm3f_ automated match to d1n0ua4 |
PDB Entry: 1zm3 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm3c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm3c4 d.58.11.0 (C:482-560) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic lqdlehdhagvplkisppv
Timeline for d1zm3c4:
View in 3D Domains from same chain: (mouse over for more information) d1zm3c1, d1zm3c2, d1zm3c3, d1zm3c5 |