Lineage for d1zm3c1 (1zm3 C:344-481)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2062651Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2062960Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2062961Protein automated matches [226946] (26 species)
    not a true protein
  7. 2062977Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)
  8. 2062986Domain d1zm3c1: 1zm3 C:344-481 [125304]
    Other proteins in same PDB: d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3b_, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3d_, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5, d1zm3f_
    automated match to d1n0ua1

Details for d1zm3c1

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1zm3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3c1 b.43.3.0 (C:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d1zm3c1:

Click to download the PDB-style file with coordinates for d1zm3c1.
(The format of our PDB-style files is described here.)

Timeline for d1zm3c1: