Lineage for d1zm3c1 (1zm3 C:344-481)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317091Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317134Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1317135Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1317136Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 1317137Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (16 PDB entries)
    Uniprot P32324
  8. 1317164Domain d1zm3c1: 1zm3 C:344-481 [125304]
    Other proteins in same PDB: d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3b1, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3d1, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5, d1zm3f1
    automatically matched to d1n0ua1

Details for d1zm3c1

PDB Entry: 1zm3 (more details), 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex
PDB Compounds: (C:) Elongation factor 2

SCOPe Domain Sequences for d1zm3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm3c1 b.43.3.1 (C:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d1zm3c1:

Click to download the PDB-style file with coordinates for d1zm3c1.
(The format of our PDB-style files is described here.)

Timeline for d1zm3c1: