SCOPe 2.04: Domain d1zm3a1: 1zm3 A:344-481

Lineage for d1zm3a1 (1zm3 A:344-481)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (16 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)

8. Domain d1zm3a1: 1zm3 A:344-481 [125298]
   Other proteins in same PDB: d1zm3a2, d1zm3a3, d1zm3a4, d1zm3a5, d1zm3b_, d1zm3c2, d1zm3c3, d1zm3c4, d1zm3c5, d1zm3d_, d1zm3e2, d1zm3e3, d1zm3e4, d1zm3e5, d1zm3f_
   automated match to d1n0ua1

Details for d1zm3a1

PDB Entry: 1zm3, 3.07 Å

PDB Description: Structure of the apo eEF2-ETA complex

PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d1zm3a1:

Sequence; same for both SEQRES and ATOM records:

>d1zm3a1 b.43.3.0 (A:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

Timeline for d1zm3a1:

• d1zm3a1 first appeared in SCOP 1.73
  
• d1zm3a1 appears in SCOPe 2.03
  
• d1zm3a1 appears in SCOPe 2.05
  
• d1zm3a1 appears in the current release, SCOPe 2.08