Lineage for d1zm2e5 (1zm2 E:726-842)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196480Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2196570Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2196571Protein automated matches [254469] (2 species)
    not a true protein
  7. 2196572Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries)
  8. 2196586Domain d1zm2e5: 1zm2 E:726-842 [125296]
    Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2b_, d1zm2c1, d1zm2c2, d1zm2c3, d1zm2d_, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2f_
    automated match to d1n0ua5
    complexed with apr

Details for d1zm2e5

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (E:) Elongation factor 2

SCOPe Domain Sequences for d1zm2e5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm2e5 d.58.11.0 (E:726-842) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOPe Domain Coordinates for d1zm2e5:

Click to download the PDB-style file with coordinates for d1zm2e5.
(The format of our PDB-style files is described here.)

Timeline for d1zm2e5: