| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
| Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
| Protein automated matches [254469] (4 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255012] (4 PDB entries) |
| Domain d1zm2e4: 1zm2 E:482-560 [125295] Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2b_, d1zm2c1, d1zm2c2, d1zm2c3, d1zm2d_, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2f_ automated match to d1n0ua4 complexed with apr |
PDB Entry: 1zm2 (more details), 3.07 Å
SCOPe Domain Sequences for d1zm2e4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm2e4 d.58.11.0 (E:482-560) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv
Timeline for d1zm2e4:
View in 3DDomains from same chain: (mouse over for more information) d1zm2e1, d1zm2e2, d1zm2e3, d1zm2e5 |