Lineage for d1zm2e3 (1zm2 E:561-725)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716673Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 716674Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)
  7. 716675Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)
  8. 716694Domain d1zm2e3: 1zm2 E:561-725 [125294]
    Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a4, d1zm2a5, d1zm2b1, d1zm2c1, d1zm2c2, d1zm2c4, d1zm2c5, d1zm2d1, d1zm2e1, d1zm2e2, d1zm2e4, d1zm2e5, d1zm2f1
    automatically matched to d1n0ua3
    complexed with apr, dde

Details for d1zm2e3

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (E:) Elongation factor 2

SCOP Domain Sequences for d1zm2e3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm2e3 d.14.1.1 (E:561-725) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiq

SCOP Domain Coordinates for d1zm2e3:

Click to download the PDB-style file with coordinates for d1zm2e3.
(The format of our PDB-style files is described here.)

Timeline for d1zm2e3: