Lineage for d1zm2d1 (1zm2 D:399-602)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441943Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1441944Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1441945Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 1442031Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 1442032Species Pseudomonas aeruginosa [TaxId:287] [56407] (10 PDB entries)
  8. 1442052Domain d1zm2d1: 1zm2 D:399-602 [125291]
    Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2c1, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5
    automatically matched to d1ikpa2
    complexed with apr

Details for d1zm2d1

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (D:) exotoxin a

SCOPe Domain Sequences for d1zm2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm2d1 d.166.1.1 (D:399-602) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
eflgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrar
sqdldaiwrgfyiagdpalaygyaqdqepdargrirngallrvyvprsslpgfyrtsltl
aapeaageverlighplplrldaitgpeeeggrletilgwplaertvvipsaiptdprnv
ggdldpssipdkeqaisalpdyas

SCOPe Domain Coordinates for d1zm2d1:

Click to download the PDB-style file with coordinates for d1zm2d1.
(The format of our PDB-style files is described here.)

Timeline for d1zm2d1: