Lineage for d1zm2a5 (1zm2 A:726-842)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862792Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 862793Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 862794Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 862795Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
    Uniprot P32324
  8. 862821Domain d1zm2a5: 1zm2 A:726-842 [125284]
    Other proteins in same PDB: d1zm2a1, d1zm2a2, d1zm2a3, d1zm2b1, d1zm2c1, d1zm2c2, d1zm2c3, d1zm2d1, d1zm2e1, d1zm2e2, d1zm2e3, d1zm2f1
    automatically matched to d1n0ua5
    complexed with apr, dde

Details for d1zm2a5

PDB Entry: 1zm2 (more details), 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA
PDB Compounds: (A:) Elongation factor 2

SCOP Domain Sequences for d1zm2a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm2a5 d.58.11.1 (A:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d1zm2a5:

Click to download the PDB-style file with coordinates for d1zm2a5.
(The format of our PDB-style files is described here.)

Timeline for d1zm2a5: