SCOPe 2.05: Domain d1zm2a1: 1zm2 A:344-481

Lineage for d1zm2a1 (1zm2 A:344-481)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.0: automated matches [227211] (1 protein)
   not a true family

6. Protein automated matches [226946] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255011] (4 PDB entries)

8. Domain d1zm2a1: 1zm2 A:344-481 [125280]
   Other proteins in same PDB: d1zm2a2, d1zm2a3, d1zm2a4, d1zm2a5, d1zm2b_, d1zm2c2, d1zm2c3, d1zm2c4, d1zm2c5, d1zm2d_, d1zm2e2, d1zm2e3, d1zm2e4, d1zm2e5, d1zm2f_
   automated match to d1n0ua1
   complexed with apr

Details for d1zm2a1

PDB Entry: 1zm2, 3.07 Å

PDB Description: Structure of ADP-ribosylated eEF2 in complex with catalytic fragment of ETA

PDB Compounds: (A:) Elongation factor 2

SCOPe Domain Sequences for d1zm2a1:

Sequence; same for both SEQRES and ATOM records:

>d1zm2a1 b.43.3.0 (A:344-481) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

Timeline for d1zm2a1:

• d1zm2a1 first appeared in SCOP 1.73
  
• d1zm2a1 appears in SCOPe 2.04
  
• d1zm2a1 appears in SCOPe 2.06
  
• d1zm2a1 appears in the current release, SCOPe 2.08