SCOP 1.75: Domain d1zm0b1: 1zm0 B:243-347

Lineage for d1zm0b1 (1zm0 B:243-347)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
   Pfam PF00169

6. Protein Pleckstrin [50740] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50741] (6 PDB entries)

8. Domain d1zm0b1: 1zm0 B:243-347 [125277]
   automatically matched to 1ZM0 A:243-347

Details for d1zm0b1

PDB Entry: 1zm0, 2.1 Å

PDB Description: crystal structure of the carboxyl terminal ph domain of pleckstrin to 2.1 angstroms

PDB Compounds: (B:) Pleckstrin

SCOP Domain Sequences for d1zm0b1:

Sequence, based on SEQRES records:

>d1zm0b1 b.55.1.1 (B:243-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
gviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsves
nsngrkseeenlfeiitadevhyflqaatpkertewikaiqmasr

Sequence, based on observed residues (ATOM records):

>d1zm0b1 b.55.1.1 (B:243-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]}
gviikqgcllkqghrrknwkvrkfilredpaylhyydpagaedplgaihlrgcvvtsvee
eenlfeiitadevhyflqaatpkertewikaiqmasr

Timeline for d1zm0b1:

• d1zm0b1 first appeared in SCOP 1.73
  
• d1zm0b1 is called d1zm0b_ in SCOPe 2.01
  
• d1zm0b1 appears in the current release, SCOPe 2.08, called d1zm0b_