Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [54721] (7 species) |
Species Escherichia coli [TaxId:562] [54722] (11 PDB entries) |
Domain d1zlzb2: 1zlz B:91-205 [125275] Other proteins in same PDB: d1zlza1, d1zlzb1 automatically matched to d1d5na2 complexed with azi, mh2; mutant |
PDB Entry: 1zlz (more details), 1.55 Å
SCOP Domain Sequences for d1zlzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlzb2 d.44.1.1 (B:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk
Timeline for d1zlzb2: