Lineage for d1zlza1 (1zlz A:1-90)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760436Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 760454Species Escherichia coli [TaxId:562] [46620] (11 PDB entries)
  8. 760461Domain d1zlza1: 1zlz A:1-90 [125272]
    Other proteins in same PDB: d1zlza2, d1zlzb2
    automatically matched to d1d5na1
    complexed with azi, mh2; mutant

Details for d1zlza1

PDB Entry: 1zlz (more details), 1.55 Å

PDB Description: re-evaluation of the low-temperature azide in mn-dependent superoxide dismutase
PDB Compounds: (A:) superoxide dismutase

SCOP Domain Sequences for d1zlza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlza1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOP Domain Coordinates for d1zlza1:

Click to download the PDB-style file with coordinates for d1zlza1.
(The format of our PDB-style files is described here.)

Timeline for d1zlza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zlza2