Lineage for d1zlvh1 (1zlv H:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652328Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (19 PDB entries)
  8. 652337Domain d1zlvh1: 1zlv H:1-112 [125262]
    Other proteins in same PDB: d1zlvh2, d1zlvm2
    automatically matched to d1aqkh1
    complexed with man

Details for d1zlvh1

PDB Entry: 1zlv (more details), 2.33 Å

PDB Description: fab 2g12 + man7
PDB Compounds: (H:) FAB 2G12, heavy chain

SCOP Domain Sequences for d1zlvh1:

Sequence, based on SEQRES records: (download)

>d1zlvh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vs

Sequence, based on observed residues (ATOM records): (download)

>d1zlvh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgslsdndpfdawgpgtvvtvs

SCOP Domain Coordinates for d1zlvh1:

Click to download the PDB-style file with coordinates for d1zlvh1.
(The format of our PDB-style files is described here.)

Timeline for d1zlvh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zlvh2