SCOP 1.73: Domain d1zlsh2: 1zls H:114-227

Lineage for d1zlsh2 (1zls H:114-227)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1zlsh2: 1zls H:114-227 [125256]
   Other proteins in same PDB: d1zlsh1
   automatically matched to d1aqkh2
   complexed with man

Details for d1zlsh2

PDB Entry: 1zls, 2 Å

PDB Description: fab 2g12 + man4

PDB Compounds: (H:) FAB 2G12, heavy chain

SCOP Domain Sequences for d1zlsh2:

Sequence, based on SEQRES records:

>d1zlsh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1zlsh2 b.1.1.2 (H:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssqtyicnvnhkpsntkvdkkvep

Timeline for d1zlsh2:

• d1zlsh2 is new in SCOP 1.73
  
• d1zlsh2 appears in SCOP 1.75
  
• d1zlsh2 last appears in SCOPe 2.07