Lineage for d1zlag1 (1zla G:1014-1119)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764835Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 764836Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 764837Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 764911Protein Histone H2B [47119] (6 species)
  7. 764912Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries)
  8. 764949Domain d1zlag1: 1zla G:1014-1119 [125246]
    Other proteins in same PDB: d1zlaa1, d1zlab1, d1zlae1, d1zlaf1
    automatically matched to 1ZLA C:814-920

Details for d1zlag1

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: X-ray Structure of a Kaposi's sarcoma herpesvirus LANA peptide bound to the nucleosomal core
PDB Compounds: (G:) Xenopus laevis-like histone H2A

SCOP Domain Sequences for d1zlag1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlag1 a.22.1.1 (G:1014-1119) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk

SCOP Domain Coordinates for d1zlag1:

Click to download the PDB-style file with coordinates for d1zlag1.
(The format of our PDB-style files is described here.)

Timeline for d1zlag1: