SCOP 1.75: Domain d1zlae1: 1zla E:638-735

Lineage for d1zlae1 (1zla E:638-735)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (27 PDB entries)

8. Domain d1zlae1: 1zla E:638-735 [125244]
   Other proteins in same PDB: d1zlab1, d1zlac1, d1zlad1, d1zlaf1, d1zlag1, d1zlah1
   automatically matched to d1p3le_

Details for d1zlae1

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (E:) histone h3

SCOP Domain Sequences for d1zlae1:

Sequence; same for both SEQRES and ATOM records:

>d1zlae1 a.22.1.1 (E:638-735) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvhimpkdiqlarrirgera

Timeline for d1zlae1:

• d1zlae1 first appeared in SCOP 1.73
  
• d1zlae1 is called d1zlae_ in SCOPe 2.01
  
• d1zlae1 appears in the current release, SCOPe 2.08, called d1zlae_