Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H2A [47115] (7 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries) |
Domain d1zlac1: 1zla C:814-920 [125242] Other proteins in same PDB: d1zlaa_, d1zlab1, d1zlad1, d1zlae_, d1zlaf1, d1zlah1 protein/DNA complex |
PDB Entry: 1zla (more details), 2.9 Å
SCOPe Domain Sequences for d1zlac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zlac1 a.22.1.1 (C:814-920) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
Timeline for d1zlac1: