SCOPe 2.01: Domain d1zlac1: 1zla C:814-920

Lineage for d1zlac1 (1zla C:814-920)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (7 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (24 PDB entries)

8. Domain d1zlac1: 1zla C:814-920 [125242]
   Other proteins in same PDB: d1zlaa_, d1zlab1, d1zlad1, d1zlae_, d1zlaf1, d1zlah1
   protein/DNA complex

Details for d1zlac1

PDB Entry: 1zla, 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core

PDB Compounds: (C:) Xenopus laevis-like histone H2A

SCOPe Domain Sequences for d1zlac1:

Sequence; same for both SEQRES and ATOM records:

>d1zlac1 a.22.1.1 (C:814-920) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

Timeline for d1zlac1:

• d1zlac1 first appeared in SCOP 1.73
  
• d1zlac1 appears in SCOP 1.75
  
• d1zlac1 appears in SCOPe 2.02
  
• d1zlac1 appears in the current release, SCOPe 2.08