Lineage for d1zl7a_ (1zl7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733443Species Jararacussu (Bothrops jararacussu) [TaxId:8726] [186913] (8 PDB entries)
  8. 2733447Domain d1zl7a_: 1zl7 A: [125237]
    automated match to d1umvx_
    complexed with ca, gol

Details for d1zl7a_

PDB Entry: 1zl7 (more details), 1.6 Å

PDB Description: crystal structure of catalytically-active phospholipase a2 with bound calcium
PDB Compounds: (A:) hypotensive phospholipase A2

SCOPe Domain Sequences for d1zl7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zl7a_ a.133.1.2 (A:) automated matches {Jararacussu (Bothrops jararacussu) [TaxId: 8726]}
slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcnpk
idsytyskkngdvvcggdnpckkqicecdrvattcfrdnkdtydikywfygakncqekse
pc

SCOPe Domain Coordinates for d1zl7a_:

Click to download the PDB-style file with coordinates for d1zl7a_.
(The format of our PDB-style files is described here.)

Timeline for d1zl7a_: