SCOPe 2.01: Domain d1zked_: 1zke D:

Lineage for d1zked_ (1zke D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.6: HP1531-like [140496] (1 family)
   contains short extra helix in the loop between the two bundle-forming helices

5. Family a.30.6.1: HP1531-like [140497] (1 protein)
   Small sequence family, specific to Helicobacteraceae

6. Protein Hypothetical protein HP1531 [140498] (1 species)

7. Species Helicobacter pylori [TaxId:210] [140499] (1 PDB entry)
   Uniprot P64665 1-79

8. Domain d1zked_: 1zke D: [125189]
   automated match to d1zkea1
   complexed with mg

Details for d1zked_

PDB Entry: 1zke, 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Protein HP1531 of Unknown Function from Helicobacter pylori

PDB Compounds: (D:) Hypothetical protein HP1531

SCOPe Domain Sequences for d1zked_:

Sequence; same for both SEQRES and ATOM records:

>d1zked_ a.30.6.1 (D:) Hypothetical protein HP1531 {Helicobacter pylori [TaxId: 210]}
ghmfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlsee
verlkelinalnkikkgllvfgs

Timeline for d1zked_:

• d1zked_ first appeared in SCOP 1.73, called d1zked1
  
• d1zked_ was called d1zked1 in SCOP 1.75
  
• d1zked_ appears in SCOPe 2.02
  
• d1zked_ appears in the current release, SCOPe 2.08, called d1zked2