SCOP 1.75: Domain d1zked1: 1zke D:1-79

Lineage for d1zked1 (1zke D:1-79)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.6: HP1531-like [140496] (1 family)
   contains short extra helix in the loop between the two bundle-forming helices

5. Family a.30.6.1: HP1531-like [140497] (1 protein)
   Small sequence family, specific to Helicobacteraceae

6. Protein Hypothetical protein HP1531 [140498] (1 species)

7. Species Helicobacter pylori [TaxId:210] [140499] (1 PDB entry)
   Uniprot P64665 1-79

8. Domain d1zked1: 1zke D:1-79 [125189]
   automatically matched to 1ZKE A:1-79
   complexed with mg

Details for d1zked1

PDB Entry: 1zke, 1.6 Å

PDB Description: 1.6 A Crystal Structure of a Protein HP1531 of Unknown Function from Helicobacter pylori

PDB Compounds: (D:) Hypothetical protein HP1531

SCOP Domain Sequences for d1zked1:

Sequence; same for both SEQRES and ATOM records:

>d1zked1 a.30.6.1 (D:1-79) Hypothetical protein HP1531 {Helicobacter pylori [TaxId: 210]}
mfekirkiladiedsqneiemllklanlslgdfieikrgsmdmpkgvneafftqlseeve
rlkelinalnkikkgllvf

Timeline for d1zked1:

• d1zked1 first appeared in SCOP 1.73
  
• d1zked1 is called d1zked_ in SCOPe 2.01
  
• d1zked1 appears in the current release, SCOPe 2.08, called d1zked2