SCOPe 2.03: Domain d1zjma1: 1zjm A:10-91

Lineage for d1zjma1 (1zjm A:10-91)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (132 PDB entries)
   Uniprot P06746

8. Domain d1zjma1: 1zjm A:10-91 [125153]
   Other proteins in same PDB: d1zjma2, d1zjma3
   automated match to d1tv9a1
   protein/DNA complex; complexed with na

Details for d1zjma1

PDB Entry: 1zjm, 2.1 Å

PDB Description: Human DNA Polymerase beta complexed with DNA containing an A-A mismatched primer terminus

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1zjma1:

Sequence; same for both SEQRES and ATOM records:

>d1zjma1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d1zjma1:

• d1zjma1 first appeared in SCOP 1.73
  
• d1zjma1 appears in SCOPe 2.02
  
• d1zjma1 appears in SCOPe 2.04
  
• d1zjma1 appears in the current release, SCOPe 2.08