SCOPe 2.04: Domain d1zjka2: 1zjk A:311-363

Lineage for d1zjka2 (1zjk A:311-363)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries)
   Uniprot O00187 366-686

8. Domain d1zjka2: 1zjk A:311-363 [125150]
   Other proteins in same PDB: d1zjka1
   automatically matched to d1gpza2

Details for d1zjka2

PDB Entry: 1zjk, 2.18 Å

PDB Description: crystal structure of the zymogen catalytic region of human masp-2

PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOPe Domain Sequences for d1zjka2:

Sequence; same for both SEQRES and ATOM records:

>d1zjka2 g.18.1.1 (A:311-363) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]}
vspvqakyilkdsfsifcetgyellqghlplksftavcqkdgswdrpmpacsi

Timeline for d1zjka2:

• d1zjka2 first appeared in SCOP 1.73
  
• d1zjka2 appears in SCOPe 2.03
  
• d1zjka2 appears in SCOPe 2.05
  
• d1zjka2 appears in the current release, SCOPe 2.08