Class g: Small proteins [56992] (91 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries) Uniprot O00187 366-686 |
Domain d1zjka2: 1zjk A:311-363 [125150] Other proteins in same PDB: d1zjka1 automatically matched to d1gpza2 |
PDB Entry: 1zjk (more details), 2.18 Å
SCOPe Domain Sequences for d1zjka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zjka2 g.18.1.1 (A:311-363) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} vspvqakyilkdsfsifcetgyellqghlplksftavcqkdgswdrpmpacsi
Timeline for d1zjka2: