Lineage for d1zjka2 (1zjk A:311-363)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749292Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 749293Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 749294Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins)
    Pfam PF00084
  6. 749327Protein Complement C1R protease domains [75682] (1 species)
  7. 749328Species Human (Homo sapiens) [TaxId:9606] [75683] (4 PDB entries)
  8. 749329Domain d1zjka2: 1zjk A:311-363 [125150]
    Other proteins in same PDB: d1zjka1, d1zjka3
    automatically matched to d1gpza2
    mutant

Details for d1zjka2

PDB Entry: 1zjk (more details), 2.18 Å

PDB Description: Crystal structure of the zymogen catalytic region of human MASP-2
PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOP Domain Sequences for d1zjka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
vspvqakyilkdsfsifcetgyellqghlplksftavcqkdgswdrpmpacsi

SCOP Domain Coordinates for d1zjka2:

Click to download the PDB-style file with coordinates for d1zjka2.
(The format of our PDB-style files is described here.)

Timeline for d1zjka2: