Lineage for d1zjka2 (1zjk A:311-363)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585277Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2585278Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2585279Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2585528Protein Mannan-binding lectin serine protease 2 (MASP-2) domains [111409] (1 species)
  7. 2585529Species Human (Homo sapiens) [TaxId:9606] [111410] (2 PDB entries)
    Uniprot O00187 366-686
  8. 2585532Domain d1zjka2: 1zjk A:311-363 [125150]
    Other proteins in same PDB: d1zjka1
    automatically matched to d1gpza2

Details for d1zjka2

PDB Entry: 1zjk (more details), 2.18 Å

PDB Description: Crystal structure of the zymogen catalytic region of human MASP-2
PDB Compounds: (A:) Mannan-binding lectin serine protease 2

SCOPe Domain Sequences for d1zjka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zjka2 g.18.1.1 (A:311-363) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]}
vspvqakyilkdsfsifcetgyellqghlplksftavcqkdgswdrpmpacsi

SCOPe Domain Coordinates for d1zjka2:

Click to download the PDB-style file with coordinates for d1zjka2.
(The format of our PDB-style files is described here.)

Timeline for d1zjka2: