![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain [110241] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110242] (2 PDB entries) Uniprot O00187 366-686 |
![]() | Domain d1zjka1: 1zjk A:445-686 [125149] Other proteins in same PDB: d1zjka2, d1zjka3 automatically matched to d1q3xa1 |
PDB Entry: 1zjk (more details), 2.18 Å
SCOPe Domain Sequences for d1zjka1:
Sequence, based on SEQRES records: (download)
>d1zjka1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg gkdscrgdsggalvfldseterwfvggivswgsmncgeagqygvytkvinyipwieniis df
>d1zjka1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iyggqkakpgdfpwqvlilggttaagallydnwvltaahavyeqkhdasaldirmgtlkr lsphytqawseavfihegythdagfdndialiklnnkvvinsnitpiclprkeaesfmrt ddigtasgwgltqrgflarnlmyvdipivdhqkctaayekppyprgsvtanmlcaglesg gkdscrgdsggalvfldseterwfvggivswgsmnceagqygvytkvinyipwieniisd f
Timeline for d1zjka1: