Lineage for d1zhna1 (1zhn A:186-279)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784362Protein CD1, alpha-3 domain [88615] (4 species)
  7. 784378Species Mouse (Mus musculus) [TaxId:10090] [88616] (7 PDB entries)
  8. 784387Domain d1zhna1: 1zhn A:186-279 [125105]
    Other proteins in same PDB: d1zhna2, d1zhnb1
    automatically matched to d1cd1a1
    complexed with fuc, gol, man, nag, pc6

Details for d1zhna1

PDB Entry: 1zhn (more details), 2.8 Å

PDB Description: Crystal Structure of mouse CD1d bound to the self ligand phosphatidylcholine
PDB Compounds: (A:) CD1d1 antigen

SCOP Domain Sequences for d1zhna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhna1 b.1.1.2 (A:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

SCOP Domain Coordinates for d1zhna1:

Click to download the PDB-style file with coordinates for d1zhna1.
(The format of our PDB-style files is described here.)

Timeline for d1zhna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zhna2
View in 3D
Domains from other chains:
(mouse over for more information)
d1zhnb1