Lineage for d1zhbj2 (1zhb J:3-180)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183074Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (23 PDB entries)
  8. 2183097Domain d1zhbj2: 1zhb J:3-180 [125091]
    Other proteins in same PDB: d1zhba1, d1zhbb_, d1zhbd1, d1zhbe_, d1zhbg1, d1zhbh_, d1zhbj1, d1zhbk_
    automatically matched to d1ddha2

Details for d1zhbj2

PDB Entry: 1zhb (more details), 2.7 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue peptide derived from rat dopamine beta-monooxigenase
PDB Compounds: (J:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1zhbj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zhbj2 d.19.1.1 (J:3-180) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
hsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywer
etqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegrd
yialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll

SCOPe Domain Coordinates for d1zhbj2:

Click to download the PDB-style file with coordinates for d1zhbj2.
(The format of our PDB-style files is described here.)

Timeline for d1zhbj2: