Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
Protein Hypothetical protein TM0312 [143544] (1 species) |
Species Thermotoga maritima [TaxId:2336] [143545] (1 PDB entry) Uniprot Q9WYE8 132-275 |
Domain d1zh8a2: 1zh8 A:132-275 [125078] Other proteins in same PDB: d1zh8a1, d1zh8b1 complexed with edo, na, nap |
PDB Entry: 1zh8 (more details), 2.5 Å
SCOPe Domain Sequences for d1zh8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh8a2 d.81.1.5 (A:132-275) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} hvpafwkakelvesgaigdpvfmnwqiwvgmdennkyvhtdwrkkpkhvggflsdggvhh aaamrlilgeiewisavakdlspllggmdflssifefengtvgnytisyslkgnerfeit gtkgkisiswdkivlneeemkvpq
Timeline for d1zh8a2: