Lineage for d1zh5b2 (1zh5 B:104-189)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908527Protein Lupus LA protein [89940] (1 species)
  7. 1908528Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)
  8. 1908530Domain d1zh5b2: 1zh5 B:104-189 [125076]
    Other proteins in same PDB: d1zh5a1, d1zh5b1
    automated match to d1zh5a2
    protein/RNA complex; complexed with so4

Details for d1zh5b2

PDB Entry: 1zh5 (more details), 1.85 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
PDB Compounds: (B:) Lupus La protein

SCOPe Domain Sequences for d1zh5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zh5b2 d.58.7.1 (B:104-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
ykndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsies
akkfvetpgqkyketdllilfkddyf

SCOPe Domain Coordinates for d1zh5b2:

Click to download the PDB-style file with coordinates for d1zh5b2.
(The format of our PDB-style files is described here.)

Timeline for d1zh5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zh5b1