Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Lupus LA protein [89940] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries) |
Domain d1zh5b2: 1zh5 B:104-189 [125076] Other proteins in same PDB: d1zh5a1, d1zh5b1 automated match to d1zh5a2 protein/RNA complex; complexed with so4 |
PDB Entry: 1zh5 (more details), 1.85 Å
SCOPe Domain Sequences for d1zh5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh5b2 d.58.7.1 (B:104-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} ykndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsies akkfvetpgqkyketdllilfkddyf
Timeline for d1zh5b2: