SCOP 1.73: Domain d1zh5a2: 1zh5 A:105-189

Lineage for d1zh5a2 (1zh5 A:105-189)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Lupus LA protein [89940] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89941] (4 PDB entries)

8. Domain d1zh5a2: 1zh5 A:105-189 [125074]
   Other proteins in same PDB: d1zh5a1, d1zh5b1
   automatically matched to d1s79a_
   complexed with so4

Details for d1zh5a2

PDB Entry: 1zh5, 1.85 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen

PDB Compounds: (A:) Lupus La protein

SCOP Domain Sequences for d1zh5a2:

Sequence; same for both SEQRES and ATOM records:

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
kndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesa
kkfvetpgqkyketdllilfkddyf

Timeline for d1zh5a2:

• d1zh5a2 is new in SCOP 1.73
  
• d1zh5a2 appears in SCOP 1.75
  
• d1zh5a2 appears in the current release, SCOPe 2.08