Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Escherichia coli [TaxId:562] [186855] (6 PDB entries) |
Domain d1zh4a_: 1zh4 A: [125071] automated match to d1mvoa_ complexed with bef, mg |
PDB Entry: 1zh4 (more details), 2.2 Å
SCOPe Domain Sequences for d1zh4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zh4a_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs q
Timeline for d1zh4a_: