SCOPe 2.06: Domain d1zh4a_: 1zh4 A:

Lineage for d1zh4a_ (1zh4 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (6 PDB entries)

8. Domain d1zh4a_: 1zh4 A: [125071]
   automated match to d1mvoa_
   complexed with bef, mg

Details for d1zh4a_

PDB Entry: 1zh4, 2.2 Å

PDB Description: crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe

PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpE

SCOPe Domain Sequences for d1zh4a_:

Sequence; same for both SEQRES and ATOM records:

>d1zh4a_ c.23.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
mtnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdg
iefirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs
q

Timeline for d1zh4a_:

• d1zh4a_ first appeared in SCOP 1.73, called d1zh4a1
  
• d1zh4a_ appears in SCOPe 2.05
  
• d1zh4a_ appears in SCOPe 2.07
  
• d1zh4a_ appears in the current release, SCOPe 2.08