SCOP 1.75: Domain d1zh2a1: 1zh2 A:2-120

Lineage for d1zh2a1 (1zh2 A:2-120)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein Transcriptional regulatory protein KdpE, N-terminal domain [142025] (1 species)

7. Species Escherichia coli [TaxId:562] [142026] (2 PDB entries)
   Uniprot P21866 2-120

8. Domain d1zh2a1: 1zh2 A:2-120 [125069]
   complexed with ca; mutant

Details for d1zh2a1

PDB Entry: 1zh2, 2 Å

PDB Description: crystal structure of the calcium-bound receiver domain of kdp potassium transport system response regulator kdpe

PDB Compounds: (A:) KDP operon transcriptional regulatory protein kdpE

SCOP Domain Sequences for d1zh2a1:

Sequence; same for both SEQRES and ATOM records:

>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]}
tnvlivedeqairrflrtalegdgmrvfeaetlqrglleaatrkpdliildlglpdgdgi
efirdlrqwsavpvivlsarseesdkiaaldagaddylskpfgigelqarlrvalrrhs

Timeline for d1zh2a1:

• d1zh2a1 first appeared in SCOP 1.73
  
• d1zh2a1 appears in SCOPe 2.01
  
• d1zh2a1 appears in the current release, SCOPe 2.08