SCOPe 2.05: Domain d1zgzc_: 1zgz C:

Lineage for d1zgzc_ (1zgz C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186855] (6 PDB entries)

8. Domain d1zgzc_: 1zgz C: [125067]
   Other proteins in same PDB: d1zgza1
   automated match to d1nxoa_
   complexed with gol, so4

Details for d1zgzc_

PDB Entry: 1zgz, 1.8 Å

PDB Description: crystal structure of the receiver domain of tmao respiratory system response regulator torr

PDB Compounds: (C:) TorCAD operon transcriptional regulatory protein torR

SCOPe Domain Sequences for d1zgzc_:

Sequence; same for both SEQRES and ATOM records:

>d1zgzc_ c.23.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
phhivivedepvtqarlqsyftqegytvsvtasgaglreimqnqsvdlilldinlpdeng
lmltralrerstvgiilvtgrsdridrivglemgaddyvtkplelrelvvrvknllwrid

Timeline for d1zgzc_:

• d1zgzc_ first appeared in SCOP 1.73, called d1zgzc1
  
• d1zgzc_ appears in SCOPe 2.04
  
• d1zgzc_ appears in SCOPe 2.06
  
• d1zgzc_ appears in the current release, SCOPe 2.08