Lineage for d1zgub1 (1zgu B:1-76)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1194811Protein Ubiquitin [54238] (4 species)
  7. 1194820Species Human (Homo sapiens) [TaxId:9606] [54239] (101 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 1194994Domain d1zgub1: 1zgu B:1-76 [125062]
    Other proteins in same PDB: d1zgua1

Details for d1zgub1

PDB Entry: 1zgu (more details)

PDB Description: solution structure of the human mms2-ubiquitin complex
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d1zgub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zgub1 d.15.1.1 (B:1-76) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d1zgub1:

Click to download the PDB-style file with coordinates for d1zgub1.
(The format of our PDB-style files is described here.)

Timeline for d1zgub1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zgua1