Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (29 PDB entries) |
Domain d1zglt1: 1zgl T:3-118 [125051] Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp2, d1zglr2, d1zglt2, d1zglv2 automatically matched to d1bd2e1 |
PDB Entry: 1zgl (more details), 2.8 Å
SCOPe Domain Sequences for d1zglt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zglt1 b.1.1.1 (T:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpg rfsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvve
Timeline for d1zglt1: