SCOPe 2.04: Domain d1zglr2: 1zgl R:119-240

Lineage for d1zglr2 (1zgl R:119-240)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d1zglr2: 1zgl R:119-240 [125050]
   Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglr1, d1zglt1, d1zglv1
   automatically matched to d1bd2e2

Details for d1zglr2

PDB Entry: 1zgl, 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a

PDB Compounds: (R:) T cell receptor beta chain

SCOPe Domain Sequences for d1zglr2:

Sequence; same for both SEQRES and ATOM records:

>d1zglr2 b.1.1.2 (R:119-240) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
sa

Timeline for d1zglr2:

• d1zglr2 first appeared in SCOP 1.73
  
• d1zglr2 appears in SCOPe 2.03
  
• d1zglr2 appears in SCOPe 2.05
  
• d1zglr2 appears in the current release, SCOPe 2.08