Lineage for d1zglp2 (1zgl P:119-244)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786857Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 786890Domain d1zglp2: 1zgl P:119-244 [125048]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglr1, d1zglt1, d1zglv1
    automatically matched to d1bd2e2

Details for d1zglp2

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (P:) T cell receptor beta chain

SCOP Domain Sequences for d1zglp2:

Sequence, based on SEQRES records: (download)

>d1zglp2 b.1.1.2 (P:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawg

Sequence, based on observed residues (ATOM records): (download)

>d1zglp2 b.1.1.2 (P:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqatlvclatgfypdhvelswwvngkevhsgvstdpqp
lkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawg

SCOP Domain Coordinates for d1zglp2:

Click to download the PDB-style file with coordinates for d1zglp2.
(The format of our PDB-style files is described here.)

Timeline for d1zglp2: