![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
![]() | Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
![]() | Domain d1zglh1: 1zgl H:93-189 [125041] Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb2, d1zgld1, d1zgld2, d1zgle2, d1zglg1, d1zglg2, d1zglh2, d1zglj1, d1zglj2, d1zglk2, d1zglp1, d1zglp2, d1zglr1, d1zglr2, d1zglt1, d1zglt2, d1zglv1, d1zglv2 automatically matched to d1fv1b1 |
PDB Entry: 1zgl (more details), 2.8 Å
SCOPe Domain Sequences for d1zglh1:
Sequence, based on SEQRES records: (download)
>d1zglh1 b.1.1.2 (H:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewr
>d1zglh1 b.1.1.2 (H:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypanllvcsvngfypgsievrwfvvstgliqngdwtfqtlvmlesgevytc qvehpsvtspltvewr
Timeline for d1zglh1: