Lineage for d1zglg1 (1zgl G:83-179)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107077Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1107127Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1107164Domain d1zglg1: 1zgl G:83-179 [125039]
    Other proteins in same PDB: d1zgla2, d1zglb1, d1zglb2, d1zgld2, d1zgle1, d1zgle2, d1zglg2, d1zglh1, d1zglh2, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglp2, d1zglr1, d1zglr2, d1zglt1, d1zglt2, d1zglv1, d1zglv2
    automatically matched to d1k2da1

Details for d1zglg1

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (G:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1zglg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zglg1 b.1.1.2 (G:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOPe Domain Coordinates for d1zglg1:

Click to download the PDB-style file with coordinates for d1zglg1.
(The format of our PDB-style files is described here.)

Timeline for d1zglg1: