SCOPe 2.06: Domain d1zgla1: 1zgl A:83-179

Lineage for d1zgla1 (1zgl A:83-179)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1zgla1: 1zgl A:83-179 [125031]
   Other proteins in same PDB: d1zgla2, d1zglb1, d1zglb2, d1zgld2, d1zgle1, d1zgle2, d1zglg2, d1zglh1, d1zglh2, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3
   automatically matched to d1k2da1

Details for d1zgla1

PDB Entry: 1zgl, 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a

PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1zgla1:

Sequence; same for both SEQRES and ATOM records:

>d1zgla1 b.1.1.2 (A:83-179) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpred
hlfrkfhylpflpstedvydcrvehwgldepllkhwe

Timeline for d1zgla1:

• d1zgla1 first appeared in SCOP 1.73
  
• d1zgla1 appears in SCOPe 2.05
  
• d1zgla1 appears in SCOPe 2.07
  
• d1zgla1 appears in the current release, SCOPe 2.08